HPA000932

LRP10 antibody from Sigma-Aldrich
DKFZP564C1940, LRP9, MGC8675, MST087, MSTP087
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000932, RRID:AB_2281523
Product name
Anti-LRP10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000932
Antibody type
Polyclonal
Antigen
Low-density lipoprotein receptor-related protein 10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCT
WLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQP
LISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQG
FLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDG
Storage
-20C
Provider Type Product Number
- No reagents -