HPA002132

ESYT2 antibody from Atlas Antibodies
CHR2SYT, FAM62B, KIAA1228
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002132
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002132, RRID:AB_1078807
Product name
Anti-ESYT2
Provider product page
Atlas Antibodies - HPA002132
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIK
ADKDQANDGLSSALLILYLDSARNLPSGKKISSNP
NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIH
NPKRQDLEVEVRDEQHQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -