HPA002132

ESYT2 antibody from Sigma-Aldrich
CHR2SYT, FAM62B, KIAA1228
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002132, RRID:AB_1078807
Product name
Anti-FAM62B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002132
Antibody type
Polyclonal
Antigen
Protein FAM62B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIK
ADKDQANDGLSSALLILYLDSARNLPSGKKISSNP
NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIH
NPKRQDLEVEVRDEQHQ
Storage
-20C
Provider Type Product Number
- No reagents -