Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28569 - Provider product page
- Provider
- Abnova Corporation
- Product name
- SULT1B1 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant SULT1B1.
- Antigen sequence
KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILND
GDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEK
NPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of lane 1: RT-4, lane 2: Human Plasma, lane 3: Liver and lane 4: Tonsil using SULT1B1 polyclonal antibody (Cat # PAB28569).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human spleen with SULT1B1 polyclonal antibody (Cat # PAB28569) shows strong cytoplasmic positivity in cells in red pulp. Retrieval method: HIER pH6
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)