Antibody data

Product number
H00027284-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027284-B01P, RRID:AB_1138973
Product name
SULT1B1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00027284-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SULT1B1 protein.
Antigen sequence
MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFH
SRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKC
KRGFITEKVPMLEMTPPGLRTSGIEQLEKNPSPRI
VKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSY
YHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFT
HVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIR
FLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLP
TTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAI
YETEMSKTALQFRTEI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -