Antibody data

Product number
H00027284-M04A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027284-M04A, RRID:AB_1237892
Product name
SULT1B1 monoclonal antibody (M04A), clone 4C9
Provider product page
Abnova Corporation - H00027284-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SULT1B1.
Antigen sequence
MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFH
SRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKC
KRGFITEKVPMLEMTLPGLRTSGIEQLEK
Isotype
IgM
Antibody clone number
4C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -