HPA016508

SLC39A14 antibody from Sigma-Aldrich
KIAA0062, NET34, ZIP14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016508, RRID:AB_1857148
Product name
Anti-SLC39A14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016508
Antibody type
Polyclonal
Antigen
Zinc transporter ZIP14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDH
MIPQHCSSELDGKAPMVDEKVIVGSLSVQDLQASQ
SACYWLKGVRYSDIGTLAWMITLSD
Storage
-20C
Provider Type Product Number
- No reagents -