HPA001677

GOLIM4 antibody from Sigma-Aldrich
GIMPC, GOLPH4, GPP130, P138
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001677
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001677, RRID:AB_1079017
Product name
Anti-GOLIM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001677
Antibody type
Polyclonal
Antigen
Golgi integral membrane protein 4 (Golgi phosphoprotein 4) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHA
RAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEA
QQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMA
LQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGA
ED
Storage
-20C
Provider Type Product Number
- No reagents -