H00089765-A01

RSPH1 antibody from Abnova Corporation
CILD24, FLJ32753, RSP44, RSPH10A, TSGA2

Antibody data

Product number
H00089765-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00089765-A01, RRID:AB_607243
Product name
TSGA2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00089765-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant TSGA2.
Antigen sequence
EELVTVVPKWKATQITELALWTPTLPKKPTSTDGP
GQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDE
DADVLREESREYDQEEFRYDMDEGNINSEEEETRQ
SDLQD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -