HPA016816

RSPH1 antibody from Sigma-Aldrich
CILD24, FLJ32753, RSP44, RSPH10A, TSGA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016816
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016816, RRID:AB_1858393
Product name
Anti-TSGA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016816
Antibody type
Polyclonal
Antigen
Radial spoke head 1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGE
MDMRPGDEDADVLREESREYDQEEFRYDMDEGNIN
SEEEETRQSDLQD
Storage
-20C
Provider Type Product Number
- No reagents -