HPA016816

RSPH1 antibody from Atlas Antibodies
CILD24, FLJ32753, RSP44, RSPH10A, TSGA2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016816
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016816, RRID:AB_1858393
Product name
Anti-RSPH1
Provider product page
Atlas Antibodies - HPA016816
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGE
MDMRPGDEDADVLREESREYDQEEFRYDMDEGNIN
SEEEETRQSDLQD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -