HPA001768

MYO1C antibody from Atlas Antibodies
myr2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001768
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001768, RRID:AB_1854252
Product name
Anti-MYO1C
Provider product page
Atlas Antibodies - HPA001768
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDK
SDWKVVRKALTVIDFTEDEVEDLLSIVASVLHLGN
IHFAANEESNAQVTTENQLKYLTRLLSVEGSTLRE
ALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVY
SRTFTWLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -