HPA001768

MYO1C antibody from Sigma-Aldrich
myr2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001768
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001768, RRID:AB_1854252
Product name
Anti-MYO1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001768
Antibody type
Polyclonal
Antigen
Myosin-Ic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDK
SDWKVVRKALTVIDFTEDEVEDLLSIVASVLHLGN
IHFAANEESNAQVTTENQLKYLTRLLSVEGSTLRE
ALTHRKIIAKGEELLSPLNLEQAAYARDALAKAVY
SRTFTWLV
Storage
-20C
Provider Type Product Number
- No reagents -