HPA020638

PRPF4B antibody from Atlas Antibodies
KIAA0536, PR4H, Prp4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020638
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020638, RRID:AB_1855774
Product name
Anti-PRPF4B
Provider product page
Atlas Antibodies - HPA020638
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAED
SNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVK
EYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLL
APDMF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -