Antibody data

Product number
H00008899-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008899-M01, RRID:AB_1137393
Product name
PRPF4B monoclonal antibody (M01), clone 3E10
Provider product page
Abnova Corporation - H00008899-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PRPF4B.
Antigen sequence
LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYI
EVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPE
DQRKKVHQLKDLLDQILMLDPAKRISINQALQHAF
IQE
Isotype
IgG
Antibody clone number
3E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -