HPA020638

PRPF4B antibody from Sigma-Aldrich
KIAA0536, PR4H, Prp4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020638, RRID:AB_1855774
Product name
Anti-PRPF4B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020638
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PRP4 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAED
SNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVK
EYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLL
APDMF
Storage
-20C
Provider Type Product Number
- No reagents -