ABIN1544935

CRNKL1 antibody from antibodies-online
CLF, Clf1, CRN, SYF3

Antibody data

Product number
ABIN1544935
Provider
antibodies-online
Product name
anti-Crooked Neck Pre-MRNA Splicing Factor-Like 1 (Drosophila) (CRNKL1) (C-Term) antibody
Provider product page
antibodies-online - ABIN1544935
Antibody type
Polyclonal
Antigen
The immunogen for Anti-CRNKL1 antibody is: synthetic peptide directed towards the C-terminal region of Human CRNKL1
Reactivity
Human
Host
Rabbit
Antigen sequence
SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGS
DAGWE EYFDYIFPED
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -