HPA016708

PHF11 antibody from Sigma-Aldrich
BCAP, IGER, NY-REN-34
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016708
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016708, RRID:AB_1855286
Product name
Anti-PHF11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016708
Antibody type
Polyclonal
Antigen
PHD finger protein 11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEK
LMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAI
EKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENR
DLMSSSTSISSLSY
Storage
-20C
Provider Type Product Number
- No reagents -