HPA002109

KIAA2026 antibody from Sigma-Aldrich
FLJ20375
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002109
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002109, RRID:AB_1078071
Product name
Anti-KIAA2026 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002109
Antibody type
Polyclonal
Antigen
KIAA2026 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APGGTTIHTASAPSNVTSLVGSQFSEPCIQQKIVI
NTSTPLAPGTQIMINGTRFIVPPQGLGAGSHVLLI
STNPKYGAPLVLNSGQGIQSTPIDNSAQKITLASN
NSLSGQPLQHPLRSPTK
Storage
-20C
Provider Type Product Number
- No reagents -