HPA022130

ECI2 antibody from Atlas Antibodies
ACBD2, DRS1, HCA88, PECI
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022130
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022130, RRID:AB_1855176
Product name
Anti-ECI2
Provider product page
Atlas Antibodies - HPA022130
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRK
STGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH
EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNF
TDIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -