Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA022130 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA022130, RRID:AB_1855176
- Product name
- Anti-ECI2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SLPKEAARQNYVDLVSSLSPSLESSSQVEPGTDRK
STGFETLVVTSEDGITKIMFNRPKKKNAINTEMYH
EIMRALKAASKDDSIITVLTGNGDYYSSGNDLTNF
TDIP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-ECI2 antibody HPA022130 (A) shows similar pattern to independent antibody HPA031626 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & vesicles.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and skin tissues using HPA022130 antibody. Corresponding ECI2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle, kidney, liver and testis using Anti-ECI2 antibody HPA022130 (A) shows similar protein distribution across tissues to independent antibody HPA031626 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows very weak positivity in epidermal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle using Anti-ECI2 antibody HPA022130.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-ECI2 antibody HPA022130.
- Sample type
- HUMAN