HPA005653

MAFB antibody from Sigma-Aldrich
KRML
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005653, RRID:AB_1079293
Product name
Anti-MAFB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005653
Antibody type
Polyclonal
Antigen
Transcription factor MafB recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPA
GSVSSTPLSTPCSSVPSSPSFSPTEQKTHLEDLYW
MASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQ
SFDSFRGAHHHHHHHHPH
Storage
-20C
Provider Type Product Number
- No reagents -