HPA002704

MAPK15 antibody from Sigma-Aldrich
ERK7, ERK8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002704
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002704, RRID:AB_1079307
Product name
Anti-MAPK15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002704
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTDAQRTFREITLLQEFGDHPNIISLLDVIRAEND
RDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCD
F
Storage
-20C
Provider Type Product Number
- No reagents -