HPA020513

FAM71F2 antibody from Sigma-Aldrich
FAM137B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020513
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020513, RRID:AB_1853077
Product name
Anti-FAM71F2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020513
Antibody type
Polyclonal
Antigen
Protein FAM71F2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ITTKDPRIKFTHCLVPKMPTNSTETTPENSLLSSP
QPSEPLVLLAAEQTSGSFSQLSGKPQLT
Storage
-20C
Provider Type Product Number
- No reagents -