HPA001868

antibody from Atlas Antibodies

Targeting: PRX KIAA1620

Antibody data

Submit

Validation data

Product number: HPA001868 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA001868, RRID:AB_2172440
Product name: Anti-PRX
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVS EIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKA TKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPG EAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPS VELDL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PRX protein structure - HPA001868 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human lung and liver tissues using HPA001868 antibody. Corresponding PRX RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in glomeruli.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong membranous positivity in pneumocytes.
Sample type: HUMAN