HPA001868

PRX antibody from Sigma-Aldrich
KIAA1620
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001868
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001868, RRID:AB_2172440
Product name
Anti-PRX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001868
Antibody type
Polyclonal
Antigen
Periaxin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVS
EIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKA
TKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPG
EAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPS
VELDL
Storage
-20C
Provider Type Product Number
- No reagents -