HPA004632

SEMA5A antibody from Atlas Antibodies
SEMAF, semF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004632
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004632, RRID:AB_888865
Product name
Anti-SEMA5A
Provider product page
Atlas Antibodies - HPA004632
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGL
HTEEALCNTQPCPESWSEWSDWSECEASGVQVRAR
QCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVA
RSSSVEEKRCGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -