HPA004632

SEMA5A antibody from Sigma-Aldrich
SEMAF, semF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004632, RRID:AB_1079905
Product name
Anti-SEMA5A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004632
Antibody type
Polyclonal
Antigen
Semaphorin-5A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGL
HTEEALCNTQPCPESWSEWSDWSECEASGVQVRAR
QCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVA
RSSSVEEKRCGE
Storage
-20C
Provider Type Product Number
- No reagents -