HPA019648

GCN1 antibody from Atlas Antibodies
GCN1L, GCN1L1, KIAA0219

Antibody data

Product number
HPA019648
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019648, RRID:AB_1849567
Product name
Anti-GCN1
Provider product page
Atlas Antibodies - HPA019648
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIII
EDLLEATRSPEVGMRQAAAIILNIYCSRSKADYTS
HLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKL
DAGNQLALIEELHKEIRLIGNESKGEHVPGFC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.