HPA024367

GCN1 antibody from Sigma-Aldrich
GCN1L, GCN1L1, KIAA0219
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024367
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024367, RRID:AB_1849569
Product name
Anti-GCN1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024367
Antibody type
Polyclonal
Antigen
Translational activator GCN1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLPLLIQTVEKAASQSTQVPTITEGVAAALLLLKL
SVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMA
SEDALCTVLHLTERLFLDHPHRLTGNKVQQYHRAL
VAVLLSRTWHVRRQAQQTVRKLLSSL
Storage
-20C
Provider Type Product Number
- No reagents -