HPA018799

GCN1 antibody from Atlas Antibodies
GCN1L, GCN1L1, KIAA0219
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018799
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018799, RRID:AB_1849565
Product name
Anti-GCN1
Provider product page
Atlas Antibodies - HPA018799
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPG
LKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPAL
LARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMN
AMGSLSVLSPDRVLPQLISTITA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -