HPA019943

CCAR2 antibody from Atlas Antibodies
DBC-1, DBC1, KIAA1967, NET35
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019943
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019943, RRID:AB_1852454
Product name
Anti-CCAR2
Provider product page
Atlas Antibodies - HPA019943
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLA
FVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQ
LVSRVVTQNICQYRS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -