HPA001820

ITGB5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001820, RRID:AB_1079142
Product name
Anti-ITGB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001820
Antibody type
Polyclonal
Antigen
Integrin beta5-precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCL
CGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVEC
LLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEA
VLCFYKTAKDCVMMFTYVELPSGKSNLTVL
Storage
-20C
Provider Type Product Number
- No reagents -