HPA026563

PITPNC1 antibody from Sigma-Aldrich
RDGB-BETA, RDGBB, RDGBB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026563
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026563, RRID:AB_1855409
Product name
Anti-PITPNC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026563
Antibody type
Polyclonal
Antigen
Cytoplasmic phosphatidylinositol transfer protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FAWVDEWYDMTMDEVREFERATQGATNKKIGIFPP
AISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLS
VPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSD
KPCR
Storage
-20C
Provider Type Product Number
- No reagents -