Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023882 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023882, RRID:AB_1848429
- Product name
- Anti-FAT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLL
FVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRIL
NVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTAR
LSFVTPRHHRAAVCLCKEGRCP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genomic and molecular characterization of esophageal squamous cell carcinoma.
A Soluble Form of the Giant Cadherin Fat1 Is Released from Pancreatic Cancer Cells by ADAM10 Mediated Ectodomain Shedding
The genomic landscape of nasopharyngeal carcinoma
Quantitative temporal viromics: an approach to investigate host-pathogen interaction.
Recurrent somatic mutation of FAT1 in multiple human cancers leads to aberrant Wnt activation.
Deregulation of the Protocadherin Gene FAT1 Alters Muscle Shapes: Implications for the Pathogenesis of Facioscapulohumeral Dystrophy
Lin DC, Hao JJ, Nagata Y, Xu L, Shang L, Meng X, Sato Y, Okuno Y, Varela AM, Ding LW, Garg M, Liu LZ, Yang H, Yin D, Shi ZZ, Jiang YY, Gu WY, Gong T, Zhang Y, Xu X, Kalid O, Shacham S, Ogawa S, Wang MR, Koeffler HP
Nature genetics 2014 May;46(5):467-73
Nature genetics 2014 May;46(5):467-73
A Soluble Form of the Giant Cadherin Fat1 Is Released from Pancreatic Cancer Cells by ADAM10 Mediated Ectodomain Shedding
Wojtalewicz N, Sadeqzadeh E, Weiß J, Tehrani M, Klein-Scory S, Hahn S, Schmiegel W, Warnken U, Schnölzer M, de Bock C, Thorne R, Schwarte-Waldhoff I, Hoffmann A
PLoS ONE 2014 March;9(3)
PLoS ONE 2014 March;9(3)
The genomic landscape of nasopharyngeal carcinoma
Lin D, Meng X, Hazawa M, Nagata Y, Varela A, Xu L, Sato Y, Liu L, Ding L, Sharma A, Goh B, Lee S, Petersson B, Yu F, Macary P, Oo M, Ha C, Yang H, Ogawa S, Loh K, Koeffler H
Nature Genetics 2014 June;46(8):866-871
Nature Genetics 2014 June;46(8):866-871
Quantitative temporal viromics: an approach to investigate host-pathogen interaction.
Weekes MP, Tomasec P, Huttlin EL, Fielding CA, Nusinow D, Stanton RJ, Wang ECY, Aicheler R, Murrell I, Wilkinson GWG, Lehner PJ, Gygi SP
Cell 2014 Jun 5;157(6):1460-1472
Cell 2014 Jun 5;157(6):1460-1472
Recurrent somatic mutation of FAT1 in multiple human cancers leads to aberrant Wnt activation.
Morris LG, Kaufman AM, Gong Y, Ramaswami D, Walsh LA, Turcan Ş, Eng S, Kannan K, Zou Y, Peng L, Banuchi VE, Paty P, Zeng Z, Vakiani E, Solit D, Singh B, Ganly I, Liau L, Cloughesy TC, Mischel PS, Mellinghoff IK, Chan TA
Nature genetics 2013 Mar;45(3):253-61
Nature genetics 2013 Mar;45(3):253-61
Deregulation of the Protocadherin Gene FAT1 Alters Muscle Shapes: Implications for the Pathogenesis of Facioscapulohumeral Dystrophy
Caruso N, Herberth B, Bartoli M, Puppo F, Dumonceaux J, Zimmermann A, Denadai S, Lebossé M, Roche S, Geng L, Magdinier F, Attarian S, Bernard R, Maina F, Levy N, Helmbacher F, Cox G
PLoS Genetics 2013 June;9(6)
PLoS Genetics 2013 June;9(6)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong membranous positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in smooth muscle cells and glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows very weak positivity in myocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows moderate membranous positivity in squamous epithelial cells.
- Sample type
- HUMAN