Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001869 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001869, RRID:AB_1078818
- Product name
- Anti-FAT1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DGLGAKVSFHSLRITATDGENFATPLYINITVAAS
HKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVED
IFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSV
IFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMET
GM- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A soluble form of the giant cadherin Fat1 is released from pancreatic cancer cells by ADAM10 mediated ectodomain shedding.
Deregulation of the Protocadherin Gene FAT1 Alters Muscle Shapes: Implications for the Pathogenesis of Facioscapulohumeral Dystrophy
Wojtalewicz N, Sadeqzadeh E, Weiß JV, Tehrani MM, Klein-Scory S, Hahn S, Schmiegel W, Warnken U, Schnölzer M, de Bock CE, Thorne RF, Schwarte-Waldhoff I
PloS one 2014;9(3):e90461
PloS one 2014;9(3):e90461
Deregulation of the Protocadherin Gene FAT1 Alters Muscle Shapes: Implications for the Pathogenesis of Facioscapulohumeral Dystrophy
Caruso N, Herberth B, Bartoli M, Puppo F, Dumonceaux J, Zimmermann A, Denadai S, Lebossé M, Roche S, Geng L, Magdinier F, Attarian S, Bernard R, Maina F, Levy N, Helmbacher F, Cox G
PLoS Genetics 2013 June;9(6)
PLoS Genetics 2013 June;9(6)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
- Sample type
- HUMAN