HPA023882

FAT1 antibody from Sigma-Aldrich
CDHF7, CDHR8, FAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023882, RRID:AB_1848429
Product name
Anti-FAT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023882
Antibody type
Polyclonal
Antigen
Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLL
FVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRIL
NVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTAR
LSFVTPRHHRAAVCLCKEGRCP
Storage
-20C
Provider Type Product Number
- No reagents -