HPA005821

USP40 antibody from Sigma-Aldrich
FLJ10785
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005821
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005821, RRID:AB_1080526
Product name
Anti-USP40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005821
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLCQLESEEKQVKISATVNTMVFDIRIKAIKELKL
MKELADNSCLRPIDRNGKLLCPVPDSYTLKEAELK
MGSSLGLCLGKAPSSSQLFLFFAMGSDVQPGTEME
IVVEETISVRDCLKLMLKKSGLQGDAWHLRKMDWC
YEAGEP
Storage
-20C
Provider Type Product Number
- No reagents -