HPA023625

TNFRSF10B antibody from Atlas Antibodies
CD262, DR5, KILLER, TRAIL-R2, TRAILR2, TRICK2A, TRICKB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023625
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023625, RRID:AB_1847860
Product name
Anti-TNFRSF10B
Provider product page
Atlas Antibodies - HPA023625
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPT
ETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKV
AKAEAAGHRDTLYTMLIKWVNKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -