HPA023625

TNFRSF10B antibody from Sigma-Aldrich
CD262, DR5, KILLER, TRAIL-R2, TRICK2A, TRICKB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023625
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023625, RRID:AB_1847860
Product name
Anti-TNFRSF10B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023625
Antibody type
Polyclonal
Antigen
Tumor necrosis factor receptor superfamily member 10B Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPT
ETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKV
AKAEAAGHRDTLYTMLIKWVNKT
Storage
-20C
Provider Type Product Number
- No reagents -