HPA024184

RIOK3 antibody from Atlas Antibodies
SUDD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024184
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024184, RRID:AB_1856289
Product name
Anti-RIOK3
Provider product page
Atlas Antibodies - HPA024184
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVA
VAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQ
LRREEKKFNGDSKVSISFENYRKVHPYEDSDSSED
EVDWQDTRDDPYRPAKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -