HPA001620

RIOK3 antibody from Sigma-Aldrich
SUDD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001620
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001620, RRID:AB_1079815
Product name
Anti-RIOK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001620
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase RIO3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IGKGKDITTKHDEVVCGRKNTARMENFAPEFQVGD
GIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKE
HSTAEKAVDPKTRSLMYKMVNSGMLETITGCISTG
KESVVFHAYGGSMEDEKEDSKVIPTECA
Storage
-20C
Provider Type Product Number
- No reagents -