Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310199 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ferrochelatase (FECH) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FECH antibody: synthetic peptide directed towards the N terminal of human FECH
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGG
GSPIK IWTSKQGEGM- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references siRNA-mediated knockdown of the heme synthesis and degradation pathways: modulation of treatment effect of 5-aminolevulinic acid-based photodynamic therapy in urothelial cancer cell lines.
Production and characterization of erythropoietic protoporphyric heterodimeric ferrochelatases.
Miyake M, Ishii M, Kawashima K, Kodama T, Sugano K, Fujimoto K, Hirao Y
Photochemistry and photobiology 2009 Jul-Aug;85(4):1020-7
Photochemistry and photobiology 2009 Jul-Aug;85(4):1020-7
Production and characterization of erythropoietic protoporphyric heterodimeric ferrochelatases.
Najahi-Missaoui W, Dailey HA
Blood 2005 Aug 1;106(3):1098-104
Blood 2005 Aug 1;106(3):1098-104
No comments: Submit comment
No validations: Submit validation data