HPA001871

SH2D4A antibody from Atlas Antibodies
FLJ20967, PPP1R38, SH2A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001871
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001871, RRID:AB_1079949
Product name
Anti-SH2D4A
Provider product page
Atlas Antibodies - HPA001871
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LFFKMREEQIRRWKEREAAMERKESLPVKPRPKKE
NGKSVHWKLGADKEVWVWVMGEHHLDKPYDVLCNE
IIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQY
HDLQAPDNQQTKDIWKKVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -