HPA001919

SH2D4A antibody from Atlas Antibodies
FLJ20967, PPP1R38, SH2A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001919
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001919, RRID:AB_888887
Product name
Anti-SH2D4A
Provider product page
Atlas Antibodies - HPA001919
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELL
LSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLI
DASADAYSFLGVDQLQHATLADLVEYHKEEPITSL
GKELLLYPCGQQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -