HPA023435

TPD52L3 antibody from Sigma-Aldrich
D55, NYD-SP25
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023435
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023435, RRID:AB_1854741
Product name
Anti-TPD52L3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023435
Antibody type
Polyclonal
Antigen
Tumor protein D55 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPHARTETSVGTYESHSTSELEDLTEPEQRELKTK
LTKLEAEIVTLRHVLAAKERRCGEL
Storage
-20C
Provider Type Product Number
- No reagents -