HPA005716

SDC4 antibody from Atlas Antibodies
amphiglycan, ryudocan, SYND4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005716
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005716, RRID:AB_1080160
Product name
Anti-SDC4
Provider product page
Atlas Antibodies - HPA005716
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGS
GDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQ
VPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSS
TVQGSNIFERTEV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -