HPA001756

RREB1 antibody from Sigma-Aldrich
HNT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001756
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001756, RRID:AB_1856477
Product name
Anti-RREB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001756
Antibody type
Polyclonal
Antigen
RAS-responsive element-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATTDTNKFSPFLQTAEDNTQDEVAGAPADHHGPSD
EEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVF
PWASSLQRHMLTHTGQKPFPCQKCDAFFSTKSNCE
RHQLRKHGVTIRRAPPLSNN
Storage
-20C
Provider Type Product Number
- No reagents -