HPA026633

UHRF2 antibody from Atlas Antibodies
MGC33463, NIRF, RNF107, TDRD23, URF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026633
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026633, RRID:AB_2732431
Product name
Anti-UHRF2
Provider product page
Atlas Antibodies - HPA026633
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFL
RRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQ
LLCDECNVA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -