Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183081 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the N terminal of human UHRF2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESG
TLEMN VKDLRPRART- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references NIRF induces G1 arrest and associates with Cdk2.
[Analysis of diagnosis and misdiagnosis of pulmonary thromboembolism in emergency].
Li Y, Mori T, Hata H, Homma Y, Kochi H
Biochemical and biophysical research communications 2004 Jun 25;319(2):464-8
Biochemical and biophysical research communications 2004 Jun 25;319(2):464-8
[Analysis of diagnosis and misdiagnosis of pulmonary thromboembolism in emergency].
Liu S, Zhu XL, Zhou Y, Zhang JL, Xu XF, Li ZZ
Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue 2004 Aug;16(8):464-7
Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue 2004 Aug;16(8):464-7
No comments: Submit comment
No validations: Submit validation data