Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501312 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ubiquitin-Like with PHD and Ring Finger Domains 2, E3 Ubiquitin Protein Ligase (UHRF2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UHRF2 antibody: synthetic peptide directed towards the middle region of human UHRF2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKIS
KYAPE EGNRYDGIYK- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references ICBP90, an E2F-1 target, recruits HDAC1 and binds to methyl-CpG through its SRA domain.
Unoki M, Nishidate T, Nakamura Y
Oncogene 2004 Oct 7;23(46):7601-10
Oncogene 2004 Oct 7;23(46):7601-10
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting